Anti-CCAR1 antibody produced in rabbit

HPA007856    Human Protein Atlas characterization data

Cell division cycle and apoptosis regulator protein 1 recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

CCAR1 (cell division cycle and apoptosis regulator 1) gene encodes a co-activator protein that associates with and recruits components of the mediator and p160 coactivator complexes by nuclear receptors (NR) to target genes. In response to appropriate hormone, it is recruited to endogenous NR target genes. It is involved in the regulation of genes that are involved in cell proliferation. It also functions as a p53 coactivator and regulates transcription. Cellular stress induces microtubule-dependent formation of RNA stress granules via CCAR1 and AKAP350A, a multifunctional scaffolding protein. It is a perinuclear protein that mediates apoptosis signaling and activates caspase 9 and 3, thereby exhibiting pro-apoptotic action. It also functions as a coactivator of androgen receptor (AR) and facilitates the formation of AR transcription complex. It functions in androgen signaling and prostate tumorigenesis.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71479.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

rat, mouse, human

antibody small pack of 25 μL

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED

Q8IX12

wet ice

−20℃

human ... CCAR1(55749)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)