Anti-BCL6 antibody produced in rabbit

MFCD01633044

HPA004899    Human Protein Atlas characterization data

BCL6 (B-cell CLL/lymphoma 6) is a nuclear protein, belonging to the BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger) domain family of transcription factors. This zinc finger transcription factor has a molecular mass of 95kDa.

B-cell lymphoma 6 protein recombinant protein epitope signature tag (PrEST)

Anti-BCL6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

BCL6 (B-cell CLL/lymphoma 6) is mainly involved in the regulation of B lymphocyte development and growth. Bcl6 acts as a diagnostic marker to identify the level of severity of various diseases. It is predominantly expressed in human cancers such as lymphoid malignancy, breast cancer. In breast cancer, it is associated with the proliferation, anchorage-independent growth, migration, and invasion. It is involved in the BCL6 translocation of primary central nervous system lymphoma, which is further linked with apoptosis process. It is a prime gene in B-cell lymphomagenesis. It has been reported that BCL6 may have corealtion with the preeclampsia.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86935.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

not available in USA

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS

P41182

wet ice

−20℃

human ... BCL6(604)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)