Anti-ATIC (AB1) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human ATIC

Anti-ATIC (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

ATIC gene encodes a bifunctional enzyme 5-Amino-4-imidazolecarboxamide ribonucleotide transformylase/IMP cyclohydrolase. The enzyme is responsible for catalysis of the last two steps in the de novo synthesis of inosine 5′-monophosphate. The N-terminal domain comprise of phosphoribosylaminoimidazolecarboxamide formyltransferase activity whereas the C-terminal domain has IMP cyclohydrolase activity. Mutation in ATIC gene results in destabilization of purinosome assembly which leads to AICA-ribosiduria.

Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

30 kDa

rabbit, mouse, horse, bovine, human, rat, dog, pig

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_004035

P31939

wet ice

−20℃

human ... ATIC(471)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3