Anti-AK2 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human AK2

Anti-AK2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Adenylate kinase 2, is the isozyme of adenylate kinase encoded by AK 2 gene and is highly expressed in heart, liver and kidney. Adenylate kinase regulates the adenine nucleotide composition within a cell by impelling the reversible transfer of the γ-phosphate group from ATP to AMP, releasing two molecules of ADP.AK2 is localized in the mitochondrial intermembrane space and may facilitate during apoptosis. It also plays a pivotal role in cellular energy homeostasis and in adenine nucleotide metabolism. Additionally, it plays a crucial role in hematopoiesis.

Synthetic peptide located within the following region: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

26 kDa

human, rat, rabbit, guinea pig

0.5 mg - 1 mg/mL

western blot: suitable

NP_001616

P54819

wet ice

−20℃

human ... AK2(204)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3