抗-ADA 兔抗

MFCD01864033

HPA001399    Human Protein Atlas characterization data

Adenosine deaminase recombinant protein epitope signature tag (PrEST)

Anti-ADA antibody produced in rabbit is suitable for use as an antibody suspension bead array in affinity proteomic array to explore the potentiality of the human proteins in plasma to predict disease status during malaria infections.
Anti-ADA antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

ADA (adenosine deaminase) gene encodes an enzyme that catalyzes the hydrolysis of adenosine to inosine. It is involved in the maintenance of adenosine homeostasis and plays a role in purine metabolism. It interacts with CD26 and mediates epithelial and lymphocyte cell adhesion. It also transduces co-stimulatory signals in T cells by interacting with CD26, an integral membrane protein. Defects in this gene can cause a deficiency of ADA resulting in severe combined immunodeficiency disease (SCID) with dysfunction of both B and T lymphocytes, impaired cellular immunity and decreased production of immunoglobulins. Overexpression of this enzyme can lead to congenital hemolytic anemia.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST78236.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:5000-1:10000

GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE

P00813

wet ice

−20℃

human ... ADA(100)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)