Anti-A4GNT (AB1) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human A4GNT

Anti-A4GNT (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

A4GNT (α-1,4-N-acetylglucosaminyltransferase) gene encodes an enzyme that belongs to glycosyltransferase 32 family and is expressed predominantly in stomach and pancreas, as well as in gastric cancer cells. A4GNT facilitates the biosynthesis of mucin type glycoprotein (O-glycan). It also mediates the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans with α1,4-linkage, forming GlcNAcα1,4Galβ residues. Further, α4GnT mRNA expressed in mononuclear cell fraction of peripheral blood acts as a biomarker for pancreatic cancer.

Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

39 kDa

bovine, human

0.5 mg - 1 mg/mL

western blot: suitable

NP_057245

Q9UNA3

wet ice

−20℃

human ... A4GNT(51146)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3