PrEST Antigen MATN1

100

expressed in E. coli

>80% (SDS-PAGE)

buffered aqueous solution

predicted mol wt 26 kDa

immobilized metal affinity chromatography (IMAC)

≥0.5 mg/mL

REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV

ENSG00000162510

P21941

wet ice

−20℃

human ... MATN1(4146)

Matrilin 1 (MATN1) is also called the cartilage matrix protein (CMP) and is the major matrix component of cartilage. The gene encoding MATN1 is mapped to human chromosome 1p35.2. Matrilin 1 (MATN1) encodes a protein of 52,000 Da and exists as trimer. It has von Willebrand factor A domain. It is a glycoprotein and interacts with cartilage collagen fibrils.

Suitable as a blocking agent using corresponding antibodies.

Autoantibodies to Matrilin 1 (MATN1) is implicated in patients with autoimmune disorder, polychondritis. MATN1 inhibits new capillary and blood vessel formation and could be used for treating diseases associated with improper neovascularization. Mutations in MATN1 gene impacts the assembly process of collagen. MATN1 gene polymorphisms result in spine deformity and is associated with familial idiopathic scoliosis

Corresponding Antibody HPA028580.

Solution in 1 M urea-PBS, pH 7.4

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Prestige Antigens is a trademark of sigma-aldrich Co. LLC

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 2