PrEST Antigen LRP4

100

expressed in E. coli

>80% (SDS-PAGE)

buffered aqueous solution

predicted mol wt 32 kDa

immobilized metal affinity chromatography (IMAC)

≥0.5 mg/mL

IQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASDFVCACPDEPDSQPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAP

ENSG00000134569

O75096

wet ice

−20℃

human ... LRP4(4038)

LRP4 (low-density lipoprotein receptor-related protein 4a) is also called the multiple epidermal growth factor-like domains 7 (MEGF7). It is mapped to human chromosome 11p11.2. Low-density lipoprotein receptor-related protein 4a (LRP4) has epidermal growth factor repeat domain and four β-propeller domains.

Suitable as a blocking agent using corresponding antibodies.

It modulates wnt signal transduction pathway. It is crucial for development of limbs and is essential for neuromuscular junction formation. Mutations in the LRP4 gene is associated with Cenani-Lenz syndrome (CLS), a disorder with abnormal distal limb development. Defective splicing of LRP4 leads to mulefoot disease. Mutations in the β-propeller domains of LRP4 is implicated in congenital myasthenic syndromes, a disorder of nerve impulse transmission.

Corresponding Antibody HPA011934.

Solution in 1 M urea-PBS, pH 7.4

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Prestige Antigens is a trademark of sigma-aldrich Co. LLC

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 2