Monoclonal Anti-UGP2 antibody produced in mouse

NA.41

The UDP-glucose pyrophosphorylase 2 (UGP2 ) gene is localized on human chromosome 2p15. It has a crucial role in carbohydrate metabolism. Its product uridine diphosphate-glucose (UDP-glucose) acts as a precursor for sugar nucleotides and is involved in various pathways. The enzyme is involved in the conversion of glucose-1-phosphate and MgUTP to UDP-glucose and MgPPi.

UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI

Monoclonal Anti-UGP2 antibody produced in mouse has been used in Western blotting.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

3H3, monoclonal

buffered aqueous solution

mouse, human, rat

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_001001521

Q16851

dry ice

−20℃

human ... UGP2(7360)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)