Monoclonal Anti-TNFRSF10B antibody produced in mouse

MFCD01865566

NA.41

The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. (provided by RefSeq)

TNFRSF10B (AAH01281, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC

The gene TNFRSF10B (TNF receptor superfamily member 10b) is a tumor suppressor gene, which upon mutation, leads to a loss of chromosome p arm, a common occurrence in head and neck tumors. It inhibits tumorigenesis via apoptosis. The cytoplasmic death domain (DD) of the protein employs fas-associated death domain (FADD) and caspases to form the death-inducing signal complex (DISC) when the receptor is trimerized. This leads to activation of caspases and cell death.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2D6, monoclonal

buffered aqueous solution

human

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

BC001281

O14763

dry ice

−20℃

human ... TNFRSF10B(8795)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)