Monoclonal Anti-SPA17 antibody produced in mouse

NA.41

Sperm autoantigenic protein 17 (SPA17) gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22. SPA17 gene is located on human chromosome 11q24.2. This antigenic protein contains 151 amino acids and has a molecular weight of 17.4 kDa. This protein is highly expressed in testis and in somatic tissues.

SPA17 (NP_059121, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE

Sperm autoantigenic protein 17 (SPA17) functions as a testis specific antigen. It also mediates signal transduction, protein synthesis and unregulated growth in proliferating and neoplastic cells. Overexpression of this protein decreases the resistance of epithelial ovarian carcinoma to chemotherapy. It regulates protein kinase A-independent AKAP (A-kinase anchoring proteins) complex in both germinal and somatic cells.160 The gene is associated with rheumatoid arthritis (RA).

Solution in phosphate buffered saline, pH 7.4

mouse

unconjugated

purified immunoglobulin

primary antibodies

3B6, monoclonal

buffered aqueous solution

antigen ~37 kDa

human

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_017425

Q15506

dry ice

−20℃

human ... SPA17(53340)

13 - Non Combustible Solids

WGK 1