Monoclonal Anti-SOX9 antibody produced in mouse

mouse

unconjugated

purified immunoglobulin

primary antibodies

CL0639, monoclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human, mouse

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:500- 1:1000

IgG2a

ENSG00000125398

P48436

wet ice

−20℃

human ... SOX9(6662)

Sex determining region Y box 9 (Sox9) is a transcription protein, that belongs to the high-mobility-group box class DNA-binding proteins. It is located on human chromosome 17q24.

Recombinant protein corresponding to SRY (sex determining region Y)-box 9.

Sequence
SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR

Epitope
Binds to an epitope located within the peptide sequence SQRTHIKTEQLSPSH as determined by overlapping synthetic peptides.

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Sex determining region Y box 9 (Sox9) participates in the human development processes. It helps to maintain the pluripotent cells at the time of pancreatic organogenesis. In adult tissues, Sox9 modulates stem and progenitor cells. Haploinsufficiency of Sox9 results in campomelic dysplasia (CD), a disease characterized by bowed femurs and tibiae, hypoplastic scapulae, 11 pairs of ribs, pelvic malformations, Robin sequence and clubbed feet.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84775.

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10;12 - Combustible liquids;Non Combustible Liquids

WGK 1