Monoclonal Anti-SLC35A3 antibody produced in mouse

NA.41

Solute carrier family 35 member A3 (SLC35A3) encodes a uridine diphosphate N-acetylglucosamine transporter, which is localized in the Golgi apparatus.The gene is located on human chromosome 1p21.2.

SLC35A3 (NP_036375, 61 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATY

Solute carrier family 35 member A3 (SLC35A3) plays an important role in the glycosylation of macromolecules. The protein plays an important role in skeletal system development. Mutations of this gene is associated with complex vertebral malformation (CVM) in cattle and syndromic autism and epilepsy and arthrogryposis in humans.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

4B6, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_012243

Q9Y2D2

dry ice

−20℃

human ... SLC35A3(23443)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)