Monoclonal Anti-MSX2 antibody produced in mouse

MFCD01633881

NA.41

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. (provided by RefSeq)

MSX2 (NP_002440, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL*

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1F6, monoclonal

buffered aqueous solution

human

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_002449

P35548

dry ice

−20℃

human ... MSX2(4488)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)