Monoclonal Anti-MGAT5 antibody produced in mouse

NA.41

This gene encodes mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, a glycosyltransferase involved in the synthesis of protein-bound and lipid-bound oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the encoded protein′s activity may correlate with the progression of invasive malignancies. (provided by RefSeq)

MGAT5 (NP_002401, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD

MGAT5 (mannosyl (α-1,6-)-glycoprotein β-1,6-N-acetylglucosaminyltransferase) is involved in the biosynthesis of N-linked glycoproteins. It catalyzes the formation of β
1,6-branched N-glycans by N-acetyl-d-glucosamine transfer. MGAT5 plays a significant role in invasion and metastasis of various cancer, including glioma and hepatocellular carcinoma. It is also known to be associated with multiple sclerosis and liver fibrosis. Increased radiosensitivity of cancer cells is observed upon MGAT5 inhibition.

Solution in phosphate buffered saline, pH 7.4

mouse

unconjugated

purified immunoglobulin

primary antibodies

3E9, monoclonal

buffered aqueous solution

human

capture ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_002410

Q09328

dry ice

−20℃

human ... MGAT5(4249)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids