Monoclonal Anti-CDH17 antibody produced in mouse

NA.41

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY

The protein encoded by the gene CDH17 (Cadherin-17), also referred to as LI-cadherin, functions in cell adhesion without being dependent on cytoplasmic components, such as catenins or the actin cytoskeleton. Lower expression of this protein due to single nucleotide polymorphisms has been associated with tumor progression and lymph node metastasis of human colorectal carcinoma. It is found to regulate the signaling function of α2β1 integrin in cell adhesion and proliferation in liver metastatic cancer cells.

Solution in phosphate buffered saline, pH 7.4

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

3H2, monoclonal

buffered aqueous solution

antigen ~37.99 kDa

human

ELISA: suitable
capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

IgG1κ

NM_004063

Q12864

dry ice

−20℃

human ... CDH17(1015)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

13 - Non Combustible Solids

WGK 1