Monoclonal Anti-C1GALT1 antibody produced in mouse

NA.41

Glycoprotein-N- acetylgalactosamine 3-β- galactosyltransferase 1 (C1GALT1) is localized in the Golgi apparatus. The gene encoding it contains three exons spanning 10 kb. It is located on chromosome 7p14-p13.

C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP

Glycoprotein-N- acetylgalactosamine 3-β- galactosyltransferase 1 (C1GALT1) functions in the addition of galactose onto GalNAc residues of IgA1. Thus, it generates the core 1 O-glycan Galβ1-3GalNAα1-SerThr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. A deficiency of C1GALT1 results in IgA nephropathy, Tn syndrome and also Henoch-Schönlein purpura. It increases the proliferation of hepatocellular carcinoma cells by regulating MET glycosylation and dimerization. C1GALT1 also regulates angiogenesis, kidney development and thrombopoiesis.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1F1, monoclonal

buffered aqueous solution

human

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_020156

Q9NS00

dry ice

−20℃

human ... C1GALT1(56913)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)