SILu^TMProt TIMP2, Metalloproteinase inhibitor 2 human

NA.12

SILu^™Prot TIMP2 is a recombinant, stable isotope-labeled human TIMP2 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and ^[13C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP2 in mass-spectrometry. SILu^™Prot TIMP2 is a protein of 194 amino acids , with a calculated molecular mass of 21.7 kDa.

While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2•IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Supplied as a lyophilized powder containing phosphate buffered saline.

SILu is a trademark of sigma-aldrich Co. LLC

expressed in HEK 293 cells

200

≥98% (SDS-PAGE)

lyophilized powder

≥98% Heavy amino acids incorporation efficiency by MS

suitable for mass spectrometry (standard)

P16035

−20℃

11 - Combustible Solids

WGK 2