SILu^TMLite APOD, Apolipoprotein D human

expressed in HEK 293 cells

200

≥95% (SDS-PAGE)

lyophilized powder

P05090

ambient

−20℃

human ... APOD(347)

SILu^™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu^™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ

Supplied as a lyophilized powder containing phosphate buffered saline.

SILu is a trademark of sigma-aldrich Co. LLC

11 - Combustible Solids

WGK 2