Anti-ZSCAN21 antibody produced in mouse

NA.41

The gene ZSCAN21 (zinc finger and SCAN domain containing 21), also referred to as NY-REN-21, encodes a C2H2 type multi-finger protein that contains an N-terminal SCAN (SRE-ZBP, CTfin51, AW-1 (ZNF174), and Number 18 cDNA or ZnF20) domain and a predicted coil at the central region. The SCAN domain has the ability to form homodimers.

ZSCAN21 (NP_666019, 136 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI

The gene ZSCAN21 (zinc finger and SCAN domain containing 21) encodes a transcription factor that transcriptionally regulates the gene SNCA that encodes α-synuclein in primary neuronal cultures. α-Synuclein is a presynaptic neuronal protein that is associated with Parkinson disease (PD). Therefore, the ZSCAN21 gene may serve as a potential target in the treatment of PD.

Solution in phosphate buffered saline, pH 7.4

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2A8, monoclonal

buffered aqueous solution

antigen 35.42 kDa

human

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_145914

Q9Y5A6

dry ice

−20℃

human ... ZSCAN21(7589)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids