Anti-TRAPPC2 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human TRAPPC2

TRAPPC2 prevents MBP1-mediated transcriptional repression and antagonizes MBP1-mediated cell death. TRAPPC2 may play a role in vesicular transport from endoplasmic reticulum to Golgi.The protein encoded by this gene is thought to be part of a large multisubunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind MBP1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseuodogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants encoding distinct isoforms or having different 5′ UTRs, have been found for this gene.

Synthetic peptide located within the following region: RQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

16 kDa

human, bovine, rat, horse, dog, guinea pig, mouse

0.5 mg - 1 mg/mL

western blot: suitable

NM_014563

O14582

wet ice

−20℃

human ... TRAPPC2(6399)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3