Anti-THEX1 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human ERI1

RNA exonuclease that binds to the 3′-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2′ and 3′-hydroxyl groups at the last nucleotide of the histone 3′-end is required for efficient degradation of RNA substrates. Also able to degrade the 3′-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Requires for binding the 5′-ACCCA-3′ sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3′-end processing. Also binds to 5.8s ribosomal RNA. Binds with high affinity to the stem-loop structure of replication-dependent histone pre-mRNAs.

Synthetic peptide located within the following region: EPPRPSPEETQQCKFDGQETKGSKFITSSASDFSDPVYKEIAITNGCINR

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

40 kDa

human, rabbit, dog

0.5 mg - 1 mg/mL

western blot: suitable

NP_699163

Q8IV48

wet ice

−20℃

human ... THEX1(90459)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3