Anti-SSX2IP antibody produced in rabbit

NA.41

Afadin- and α-actinin-binding protein is encoded by the SSX2IP gene in humans. The gene encodes a protein that binds to the cancer-testis antigen Synovial Sarcoma X breakpoint 2 protein. It is associated with the cytoplasmic tail of nectin which is a Ca²⁺-independent immunoglobulin-like cell-cell adhesion molecule.

Synthetic peptide directed towards the middle region of human SSX2IP

Anti-SSX2IP antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/mL.

Afadin- and α-actinin-binding protein localizes at cell-cell adherens junctions (AJs). It acts as novel centrosome maturation factor and also as a maintenance factor during the onset of vertebrate development. It preserves centrosome integrity and mitosis during the rapid cleavage division of blastomeres in somatic cells. SSX2IP also promotes the development and metastasis of hepatocellular carcinoma and contributes to the drug resistance of hepatoma cells.

Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

68 kDa

horse, bovine, rabbit, rat, dog, human, guinea pig

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_054740

Q9Y2D8

wet ice

−20℃

human ... SSX2IP(117178)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3