Anti-RPS6KB2 antibody produced in rabbit

HPA010010    Human Protein Atlas characterization data

RPS6KB2 (ribosomal protein S6 kinase, 70kDa, polypeptide 2), also called 40S ribosomal protein S6 kinase (S6K2), and S6k1 form the two homologs of S6K protein. It is a serine/threonine kinase, which was first recognized by its homology to S6K1.

Ribosomal protein S6 kinase beta-2 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

RPS6KB2 (ribosomal protein S6 kinase, 70kDa, polypeptide 2) is a cellular protein, which is a downstream target of mTOR (mammalian target of rapamycin). It also phosphorylates S6 protein. The function of RPS6KB2 is not fully understood yet. In small cell lung cancer, this protein is thought to be essential for chemoresistance mediated by FGF2 (fibroblast growth factor 2). It also controls the activity of Akt/ protein kinase B (PKB) and cell survival. This protein is constitutively expressed during cell cycle, with peak levels during G and M phase, suggesting it might play important roles in both phases. It crosstalks with hormone receptor signaling and is involved in breast carcinogenesis, and thus, might have potential as marker for prognosis and hormone therapy response in breast cancer. RPS6KB2 is also amplified in gastric cancer and is a marker of poor prognosis of the same.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70180.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

rat, mouse, human

antibody small pack of 25 μL

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK

Q9UBS0

wet ice

−20℃

human ... RPS6KB2(6199)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)