Anti-PSG1 (AB1) antibody produced in rabbit

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

47 kDa

human

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_008836

Q6ICR4

wet ice

−20℃

human ... PSG1(5669)

Pregnancy-specific β 1-glycoproteins (PSGs), related to the carcinoembryonic antigen family, are major placental, syncytiotrophoblast derived, polypeptides also found in the bloodstream in late pregnancy. Pregnancy specific β-1-glycoprotein 1 (PSG1, B1G1, PBG1) is believe to have immunomodulatory, and proangiogenic roles during pregnancy. PSG1 together with HLA-E (human leukocyte antigen-E) may be involved in early implantation and development of the embryo.

Anti-PSG1 (AB1) polyclonal antibody reacts with human pregnancy specific β-1-glycoprotein 1.

Synthetic peptide directed towards the N terminal region of human PSG1

Anti-PSG1 (AB1) polyclonal antibody is used to tag pregnancy specific β-1-glycoprotein 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of pregnancy specific β-1-glycoprotein 1 in placenta and embryonic development.

Synthetic peptide located within the following region: SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3