Anti-PGBD1 (AB1) antibody produced in rabbit

NA.41

PGBD1 codes for a protein that belongs to the piggyBac family of proteins. The gene product is expressed in the brain.
Rabbit Anti-PGBD1 antibody recognizes human, canine, and bovine PGBD1.

Synthetic peptide directed towards the N terminal region of human PGBD1

Rabbit Anti-PGBD1 (AB1) antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.

Synthetic peptide located within the following region: MYEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHF

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

93 kDa

bovine, dog, human

0.5 mg - 1 mg/mL

western blot: suitable

NP_115896

Q96JS3

wet ice

−20℃

human ... PGBD1(84547)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1