Anti-PBX1 antibody produced in rabbit

NA.41

PBX1 is a nuclear transcription factor that may regulate osteogenesis and skeletal patterning. Studies have reported that PBX1 modulates NANOG expression in human embryonic stem cells.
Rabbit Anti-PBX1 antibody recognizes canine, chicken, human, mouse, and rat PBX1.

Synthetic peptide directed towards the N terminal region of human PBX1

Rabbit Anti-PBX1 antibody can be used for western blot (0.25μg/ml) assays.

PBX1 binds the sequence 5′-ATCAATCAA-3′. It acts as a transcriptional activator of PF4 in complex with MEIS1. It may be converted into a potent transcriptional activator by the (1;19) translocation. It also may have a role in steroidogenesis and, subsequently, sexual development and differentiation.

Synthetic peptide located within the following region: MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQI

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

47 kDa

human, mouse, bovine, rat, pig, dog

0.5 mg - 1 mg/mL

western blot: suitable

NP_002576

P40424

wet ice

−20℃

human ... PBX1(5087)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3