Anti-OTX1 (AB1) antibody produced in rabbit

NA.41

OTX1 is a transcription factor that regulates cerebellar development. High OTX2 expression has been implicated in medulloblastomas. Furthermore, studies in mice have revealed that Otx1 is related to horizontal canal morphogenesis and foramina constriction.
Rabbit Anti-OTX1 (AB1) antibody recognizes human, mouse, rat, bovine, and canine OTX1.

Synthetic peptide directed towards the middle region of human OTX1

Rabbit Anti-OTX1 (AB1) antibody can be used for western blot applications at a concentration of 1μg/ml.

OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.

Synthetic peptide located within the following region: ISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSY

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

37 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_055377

P32242

wet ice

−20℃

human ... OTX1(5013)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3