Anti-MRAP antibody produced in rabbit

HPA011024    Human Protein Atlas characterization data

MRAP (melanocortin 2 receptor accessory protein) is a small transmembrane protein which spans the cell membrane once. It is a paralogue of MRAP2. This protein resides in endoplasmic reticulum (ER) and plasma membrane. In adrenal cortex, it is expressed in glucocorticoid producing cells, in zona fasciculate and in the undifferentiated zone. It is also expressed in brain and pituitary. MRAP is composed of 172 amino acids and has a highly conserved N-terminus. Due to alternative splicing, MRAP has two isoforms which differ in their C-termini. These isoforms called MRAPα (19kDa) and MRAPβ (14kDa), exhibit same level of expression in adrenal gland. MRAPα is found predominantly in ER whereas MRAPβ is localized more in the plasma membrane. It exists as an anti-parallel homodimer. This gene is localized to human chromosome 21q22.1.

melanocortin 2 receptor accessory protein recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

MRAP (melanocortin 2 receptor accessory protein) is responsible for the transport of melanocortin 2 receptor (MC2R) from endoplasmic reticulum (ER) to the cell membrane. The antiparallel homodimer of MRAP interacts with MC2R at ER, and ensures its correct folding and transport to the cell surface. MRAP present at the cell membrane, interacts with adrenocorticotropic hormone (ACTH), and is involved in ACTH signaling pathway. Mutations in this gene cause familial glucocorticoid deficiency type 2 (FGD2), which is an autosomal recessive disorder. FGD2 presents itself in neonates and during late childhood, and is characterized by hypoglycaemia, hyperpigmentation and seizure. MRAP might also control appetite by regulating MC4R (melanocortin 2 receptor) activity in hypothalamus.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72231.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:50- 1:200

MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS

Q8TCY5

wet ice

−20℃

human ... MRAP(56246)

10 - Combustible liquids

WGK 1