Anti-LYPLA1 antibody produced in rabbit

MFCD00283209

NA.41

Synthetic peptide directed towards the middle region of human LYPLA1

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Synthetic peptide located within the following region: SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

25 kDa

rat, guinea pig, bovine, mouse, rabbit, human

0.5 mg - 1 mg/mL

western blot: suitable

O75608

wet ice

−20℃

human ... LYPLA1(10434)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3