Anti-Loxl1 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human LOXL1

Anti-LOXL1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

The encoded protein belongs to lysyl oxidase gene family and is mapped on to chromosome 15 at 15q24-q25. It is an extracellular protein with elastin and collagen as the chief substrates. It plays a crucial role in oxidizing the epsilon (ε) amino group in lysine to produce an aldehyde group. Lysyl oxidases are copper amine oxidases that facilitate the biogenesis of connective tissue by initiating the covalent crosslinking between collagens and elastin. Defect in LOXL1 gene expression is associated with exfoliation disease development.

Synthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

63 kDa

rat, guinea pig, mouse, human

0.5 mg - 1 mg/mL

western blot: suitable

NP_005567

Q08397

wet ice

−20℃

human ... LOXL1(4016)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3