Anti-LCK antibody produced in rabbit

NA.41

LCK (Lymphocyte-specific protein tyrosine kinase) gene belongs to Src family of protein tyrosine kinases (PTKs) and is localized to cytoplasm and cell membrane. It is mapped on to chromosome 1 at 1p34.3 and is organized in 13 exons, out of which, 12 are coding exons whereas one is putative 5′-noncoding exon.

Synthetic peptide directed towards the N terminal region of human LCK

Anti-LCK antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

The protein encoded by the gene plays a pivotal role in the selection and maturation of developing T-cells. Lck binds to CD3ζ and inhibits CD59-triggered Ca ²⁺ signaling. It acts directly on TCR/CD3 pathway in Jurkat T cells and hence facilitates T cell responses.

Synthetic peptide located within the following region: PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

58 kDa

human, dog, rabbit, bovine, horse, mouse, guinea pig, rat

0.5 mg - 1 mg/mL

western blot: suitable

NP_005347

P06239

wet ice

−20℃

human ... LCK(3932)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3