Anti-CXORF6 antibody produced in rabbit

NA.41

CXORF6 codes for a protein that has a mastermind-like domain. It may function as a transcriptional coactivator. Studies have reported that CXorf6 is a causative gene for hypospadias.
Rabbit Anti-CXORF6 antibody recognizes mouse, human, and canine CXORF6.

Synthetic peptide directed towards the N terminal region of human CXORF6

Rabbit Anti-CXORF6 antibody can be used for western blot applications at a concentration of 1.25 μg/ml.

CXorf6 is a protein predicted based on an ORF found in chromosome 14

Synthetic peptide located within the following region: LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

74 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_005482

Q13495

wet ice

−20℃

human ... CXORF6(10046)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3