Anti-CD247 antibody produced in rabbit

MFCD03454876

HPA008750    Human Protein Atlas characterization data

CD247 (cluster of differentiation 247), also known as T-cell receptor T3 zeta chain (CD3ξ), forms a part of the TCR (T-cell receptor)-CD3 complex. This gene is localized to human chromosome 1q22-q23 and is composed of eight exons. It is one of the four invariant subunits of TCR-CD3 complex.

T-cell surface glycoprotein CD3 zeta chain precursor recombinant protein epitope signature tag (PrEST)

Anti-CD247 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

CD247 (cluster of differentiation 247), also known as T-cell receptor T3 zeta chain (CDζ), plays an essential role in the organization, surface expression and signaling pathway of T-cell receptor (TCR)-CD3 complex. Any aberrations in these processes result in T-cell dysfunction and autoimmune disorder. Polymorphisms in this gene are linked to systemic lupus erythematosus. Variants in this gene are also linked to susceptibility to rheumatoid arthritis. In chronic hepatitis C patients, myeloid-derived suppressor cells (MDSCs) lead to persistence of viral infection and suppression of CD247 expression on CD8⁺ T-cells. Thus, MDSCs lead to dysfunction of T-cells mediated through CD247. Polymorphisms of this gene influence the response to hepatitis B vaccination, which in turn is determined by the BMI (body mass index).

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70699.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP

P20963

wet ice

−20℃

human ... CD247(919)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)