Anti-C6ORF173 antibody produced in rabbit

NA.41

C6ORF173 (chromosome 6 open reading frame 173) or CUG2 (Cancer-upregulated gene 2) gene encodes a centromere protein W, which is a component of the CENPA-NAC (nucleosome-associated) complex. It belongs to CENPW family and is predominantly expressed in ovary, liver, lung and pancreas as well as in many cancer cell types.

Synthetic peptide directed towards the N terminal region of human C6orf173

Anti-C6ORF173 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

CUG2 is a nuclear protein and is the essential component of human centromeric complex that facilitates the proper chromosome segregation during mitosis. Overexpression of CUG2 induces apoptosis in SKOV-3 cells. Additionally, it also plays a pivotal role in neuronal cell maintenance during CNS development in zebrafish.

Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

10 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_001012525

Q5EE01

wet ice

−20℃

human ... C6orf173(387103)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3