Anti-C3ORF39 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human C3orf39

Anti-C3ORF39 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

C3ORF39 also known as Protein O-linked mannose N-acetylglucosaminyltransferase 2 (POMGNT2; GTDC2) is a protein with glycosyltransferase activity. It is involved in the modification of O-mannosylated α-dystroglycan in the endoplasmic reticulum to generate N-acetyl glucosamine epitopes. Mutations in GTDC2 gene have been identified as the cause of Walker-Warburg syndrome.

Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

66 kDa

guinea pig, bovine, dog, rabbit, horse, human, mouse, rat

0.5 mg - 1 mg/mL

western blot: suitable

NP_116195

Q8NAT1

wet ice

−20℃

human ... C3orf39(84892)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3