Anti-ASAH1 antibody produced in rabbit

HPA005468    Human Protein Atlas characterization data

N-acylsphingosine amidohydrolase (ASAH1) gene is located on human chromosome 8p22-21.2. It is a 26.5kb long gene, which has 14 exons and 13 introns. This gene codes for a 55kDa protein with two subunits- 13kDa α and 40kDa β subunits. It is a glycoprotein and the two subunits are produced by auto-proteolytic cleavage. This protein is highly expressed in heart, lung, kidney and placenta and is expressed to a lesser extent in brain, liver, pancreas and skeletal muscle. ASAH1 is localized to lysosomes and human fibroblasts and macrophages secrete it extracellularly.

Acid ceramidase precursor recombinant protein epitope signature tag (PrEST)

Anti-ASAH1 antibody is suitable for chromatin immunoprecipitation (ChIP) and reChIP.
Anti-ASAH1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

N-acylsphingosine amidohydrolase (ASAH1) converts ceramide to fatty acid and sphingosine. ASAH1 deficiency leads to Farber disease (FD) or Farber lipogranulomatosis, which is a lysosomal storage disease. It is characterized by pulmonary insufficiency, painful swelling of joints and tendons, and a shortened life-span, because of the accumulation of ceramide in tissues. It regulates adrenocortical steroidogenesis by maintaining the intracellular balance of ceramide, sphingosine and sphingosine-1-phosphate. These molecules in turn act as second messengers in protein kinase A/cAMP-dependent pathway mediated steroidogenesis. Expression of ASAH1 is found to be elevated in multiple tumor types, especially prostate cancer. Studies suggest that ASAH1 is a potential therapeutic target in chemoresistant and advanced prostate cancer types.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70303.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF

Q13510

wet ice

−20℃

human ... ASAH1(427)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)