Monoclonal Anti-Atf4 antibody produced in mouse

MFCD01092263

NA.41

Activating transcription factor 4 (ATF4), is a stress-induced transcription factor, encoded by the gene mapped to human chromosome 22q13.1. ATF4 is a member of ATF/CREB (cyclic AMP response element binding protein) family of basic region-leucine zipper (bZip) transcription factors.
This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication. (provided by RefSeq)

ATF4 (NP_001666.2, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA

Monoclonal Anti-ATF4 antibody produced in mouse has been used in immunocytochemistry and western blotting.

Activating transcription factor 4 (ATF4) induces cAMP-dependent renal cyst formation. It is implicated in the regulation of genes involved in various cellular processes such as oxidative stress, amino acid synthesis, differentiation, metastasis and angiogenesis. Elevated expression of ATF4 has been observed in cancer patients.

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2B3, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

NM_001675

P18848

dry ice

−20℃

human ... ATF4(468)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)