Monoclonal Anti-ABCG1 antibody produced in mouse

NA.41

ABCG1 (ATP-binding cassette G1) gene is mapped to human chromosome 21q22.3. The encoded protein belongs to the G subfamily of ATP binding cassette (ABC) transporters. ABCG1 is expressed highly in neurons and glia in the central nervous system, brain, spleen and lungs.

ABCG1 (AAH29158, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI

ABCG1 (ATP-binding cassette G1) mediates cholesterol efflux to HDL (high density lipoprotein) for reverse cholesterol transport, in order to eliminate intracellular cholesterol. The encoded protein controls the removal of excess cholesterol from peripheral tissues and transports it to the liver. Therefore, it is involved in sterol and glucose homeostasis. Deficiency of ABCG1 in mice leads to severe age-dependent pulmonary lipidosis. ABCG1 is known to be associated with a risk for Alzheimer′s disease. Deletion of ABCG1 gene in mice model has been shown to lead to excess accumulation of neutral lipids and phospholipids in hepatocytes and in macrophages. Lack of this gene decreases tumor growth and augments tumor cellular apoptosis. ABCG1 also serves as a potential candidate for affective disorders or suicidal behavior.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2E11, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable

IgG1λ

BC029158

P45844

dry ice

−20℃

human ... ABCG1(9619)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)